General Information

  • ID:  hor000189
  • Uniprot ID:  P55320
  • Protein name:  Gonad-inhibiting hormone
  • Gene name:  NA
  • Organism:  Homarus americanus (American lobster)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  Produced in the eyestalk X-organ sinus gland complex of male and female lobsters.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ASAWFTNDECPGVMGNRDLYEKVAWVCNDCANIFRNNDVGVMCKKDCFHTMDFLWCVYATERHGEIDQFRKWVSILRA
  • Length:  78
  • Propeptide:  MVTRVGSGFSVQRVWLLLVIVVVLCGSVTQQASAWFTNDECPGVMGNRDLYEKVAWVCNDCANIFRNNDVGVMCKKDCFHTMDFLWCVYATERHGEIDQFRKWVSILRAGRK
  • Signal peptide:  MVTRVGSGFSVQRVWLLLVIVVVLCGSVTQQ
  • Modification:  T78 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits vitellogenesis in female animals. Plays a prominent role in the regulation of reproduction/molting processes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  10-47; 27-43; 30-56
  • Structure ID:  AF-P55320-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000189_AF2.pdbhor000189_ESM.pdb

Physical Information

Mass: 1051608 Formula: C403H600N112O115S9
Absent amino acids: Common amino acids: DVACN
pI: 5.63 Basic residues: 11
Polar residues: 23 Hydrophobic residues: 28
Hydrophobicity: -26.67 Boman Index: -14320
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 63.72
Instability Index: 2814.23 Extinction Coefficient cystines: 25355
Absorbance 280nm: 329.29

Literature

  • PubMed ID:  1791922
  • Title:  Primary Structure of Two Isoforms of the Vitellogenesis Inhibiting Hormone From the Lobster Homarus Americanus